PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01036422001
Common NameVIT_18s0001g06550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family FAR1
Protein Properties Length: 240aa    MW: 27163.6 Da    PI: 8.0635
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01036422001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR171.12.6e-22107192290
               FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        f ++YAk++GF+vrk k +++  ng+ + r f Cs+eg+r++++ + + ++ +r+etrtgC+ +++vk++ +g+w++tkl+leHnH l+
  GSVIVT01036422001 107 FCKKYAKRIGFTVRKGKVQRK-ANGTLKGRCFLCSCEGFRTKKHPN-QGTKYKRSETRTGCNVQIQVKLD-NGQWVITKLHLEHNHRLQ 192
                        889*************99997.8999****************9999.99999******************.***************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.3E-19107192IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSIEPYHLGR YSSIGSRPDV WGAIQESDDL VNHHRVGGSF RGLTIQDELN FDSWWSSFYS  60
GETEMAINVN GDEIGTLVNV NEKNPEDDDQ IPRRGMAFSS ELEAEEFCKK YAKRIGFTVR  120
KGKVQRKANG TLKGRCFLCS CEGFRTKKHP NQGTKYKRSE TRTGCNVQIQ VKLDNGQWVI  180
TKLHLEHNHR LQCLDTLNWP SDEVEGASGA DKVCQNFQLK LPKYFSLGTF TSKLIFFVG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4822480.0AM482248.2 Vitis vinifera contig VV78X044248.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645950.11e-158PREDICTED: uncharacterized protein LOC104877994
TrEMBLD7TLH60.0D7TLH6_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g06550.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.23e-17FAR1 family protein